proteinSequence

12 triples
GPTKB property

Random triples
Subject Object
gptkb:filgrastim recombinant human G-CSF
gptkb:Interferon_alfa-2a identical to human interferon alpha-2a
gptkb:somatropin identical to endogenous human growth hormone (191 amino acids)
gptkb:exenatide HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
gptkb:recombinant_factor_VIIa identical to human factor VIIa
gptkb:aldesleukin recombinant human interleukin-2 sequence
gptkb:MT-CO1 MFINW...LFF (truncated)
gptkb:teriparatide first 34 amino acids of human parathyroid hormone
gptkb:follitropin_alfa recombinant DNA technology
gptkb:darbepoetin_alfa recombinant DNA technology
gptkb:Aldesleukin recombinant human interleukin-2
gptkb:Salcatonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP